Tesamorelin Peptide Structure

2D structure image of CID 16137828 (Tesamorelin): PubChem Identifier: CID 16137828 URL: https://pubchem.ncbi.nlm.nih.gov/compound/16137828 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Formula: C221H366N72O67S

Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.