Q: Product Usage

Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.

Question 1

Tesamorelin Peptide Structure

Accepted Answer

2D structure image of CID 16137828 (Tesamorelin):

PubChem Identifier: CID 16137828

URL: https://pubchem.ncbi.nlm.nih.gov/compound/16137828

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Formula: C221H366N72O67S

Question 2

Product Usage

Accepted Answer

Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.

The Sun is Shining - Use Code MAY20 for 20% Off

Peptides

PCL Tesamorelin 20mg

GMP PCL CJC 1295 w DAC 5mg

PCL CJC 1295 w DAC 5mg

PCL Reconstitution Solution – 30 mL

Get In Touch!

Additional Resources

About PekCura

The Sun is Shining - Use Code MAY20 for 20% Off

PCL Tesamorelin 20mg

GMP PCL CJC 1295 w DAC 5mg cjc 1295 dac

PCL CJC 1295 w DAC 5mg cjc 1295 dac

PCL Reconstitution Solution – 30 mL

Get In Touch!

Additional Resources

About PekCura

GMP PCL CJC 1295 w DAC 5mg

PCL CJC 1295 w DAC 5mg