Information for TH9507
TH9507 is a stabilized analogue of growth hormone-releasing hormone (GHRH) that enhances pituitary GH release and elevates circulating IGF-1 levels through a hexenoyl modified 44-amino acid structure, improving plasma stability (Clemmons et al. 2017). In controlled research conditions, it has been associated with improvements in adipose tissue density and composition, as well as enhanced skeletal muscle quality, partly mediated by IGF-1 pathways (Lake et al. 2022; Adrian et al. 2018).
TH9507 Peptide Structure
Source: PubChem
PubChem Identifier: CID 16137828
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Formula: C221H366N72O67S
Molecular Weight: 5136 g/mol
Product Usage
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.















