Information for Cagrilintide
Cagrilintide is a long-acting amylin analogue designed with structural modifications—such as α helix stabilization, β-sheet suppression, and lipidation—to enhance peptide stability and extend systemic exposure (Kruse et al. 2021; D’Ascanio et al. 2024). It exhibits high in vitro potency at multiple amylin and calcitonin receptor subtypes and demonstrates prolonged activity through reversible albumin binding and receptor-specific dynamics (Cao et al. 2025).
Cagrilintide Peptide Structure
Source: PubChem
PubChem Identifier: CID 171397054
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula: C194H312N54O59S2
Molecular Weight: 4409 g/mol
Product Usage
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.









