Information for Tesamorelin
Tesamorelin is a synthetic analog of growth hormone-releasing hormone (GHRH), developed with modifications that improve its half-life.1 Considered a growth hormone secretagogue (GHS) — along with GHRP-2, sermorelin, and ipamorelin — tesamorelin promotes the release of growth hormone (GH).
Research Certificates of Analysis
8.37mg
Task #51573
Batch #HTES-0002
09/27/2024
19.89mg
Task #42396
Batch #05062024
05/12/2024
GMP Certificates of Analysis
21mg
Batch #PKTES20924
09/11/2024
Tesamorelin Peptide Structure
2D structure image of CID 16137828 (Tesamorelin):
PubChem Identifier: CID 16137828
URL: https://pubchem.ncbi.nlm.nih.gov/compound/16137828
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Formula: C221H366N72O67S
What Is Tesamorelin?
Encourages fat loss1
Promotes muscle growth1
Activates growth hormone synthesis2
Signaling cascade increases insulin production2
Reduces presence of triglycerides3
Research Studies
- Adrian, S., Scherzinger, A., Sanyal, A., Lake, J., Falutz, J., Dubé, M., Stanley, T., Grinspoon, S., Mamputu, J., Marsolais, C., Brown, T., & Erlandson, K. (2018). THE GROWTH HORMONE RELEASING HORMONE ANALOGUE, TESAMORELIN, DECREASES MUSCLE FAT AND INCREASES MUSCLE AREA IN ADULTS WITH HIV. The Journal of Frailty & Aging, 1–6. https://doi.org/10.14283/jfa.2018.45
- National Institute of Diabetes and Digestive and Kidney Diseases. (2018b, October 20). Tesamorelin. LiverTox - NCBI Bookshelf. https://www.ncbi.nlm.nih.gov/books/NBK548730/
- Falutz, J., Allas, S., Mamputu, J., Potvin, D., Kotler, D., Somero, M., Berger, D., Brown, S., Richmond, G., Fessel, J., Turner, R., & Grinspoon, S. (2008b). Long-term safety and effects of tesamorelin, a growth hormone-releasing factor analogue, in HIV patients with abdominal fat accumulation. AIDS, 22(14), 1719–1728. https://doi.org/10.1097/qad.0b013e32830a5058
Product Usage
This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
